You searched for: Proteins and Peptides

Supplier: ACROBIOSYSTEMS INC MS

Biotinylated Human TGF-Beta 1 / TGFB1 Protein, Avitag™, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Cynomolgus B7-H2 / ICOSLG Protein, His Tag, ACROBiosystems

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Human g-Glutamylcyclotransferase/CRF21 from R&D Systems is derived from E. coli. The Recombinant Human g-Glutamylcyclotransferase/CRF21 has been validated for the following applications: Enzyme Activity.

Supplier: ACROBIOSYSTEMS INC MS

Mouse PSMA / FOLH1 Protein, His Tag (active enzyme), ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Biotinylated Mouse CD8 alpha / CD8A Protein, His,Avitag™, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Biotinylated Human Mucin-1 (890-1158) Protein, His,Avitag™, ACROBiosystems

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Human ST3GAL2 Protein from R&D Systems is derived from CHO. The Recombinant Human ST3GAL2 Protein has been validated for the following applications: Enzyme Activity.

Supplier: R&D Systems

The Recombinant Human beta-Galactosidase-1/GLB1 Protein from R&D Systems is derived from CHO. The Recombinant Human beta-Galactosidase-1/GLB1 Protein has been validated for the following applications: Enzyme Activity.

Supplier: Anaspec Inc

This peptide is PAR-1 selective agonist displaying a high level of specificity to PAR-1 over PAR-2. The specificity of peptide was evaluated in cell-based calcium signaling assay using HEK293 cells. PAR-1 selective agonists can be used to study PAR-1 activation in vivo.
Sequence: AF(para - Fluoro)R - Cha - Cit - Y - NH2
MW: 883 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 21 to 44 mono-methylated at Lys-27 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2931.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 21 to 44 tri-methylated at Lys-27 with an addidtional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: R&D Systems

The Recombinant Human His6-UAF1 Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from Sf 21 (baculovirus). The Recombinant Human His6-UAF1 Protein has been validated for the following applications: Bioactivity.

Supplier: ACROBIOSYSTEMS INC MS

Human IL-13 R alpha 2 Protein, Fc Tag (MALS verified), ACROBiosystems

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Anaspec Inc

This is histone H4 (1-25) with a C-terminal GSGS linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3232.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: R&D Systems

The Recombinant Rat beta-NGF (CHO-expressed) Protein from R&D Systems is derived from CHO. The Recombinant Rat beta-NGF (CHO-expressed) Protein has been validated for the following applications: Bioactivity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: ACROBIOSYSTEMS INC MS

Human CD27 Ligand/CD70 Protein, His, Flag Tag active trimer (MALS verified), FITC-Labeled, Source: expressed from human 293 cells (HEK293). It contains AA Ser 52 - Pro 193, Predicted N-terminus: His, Synonyms: CD70, CD27LG, TNFSF7, TNFSF7G, CD27L, Size: 200uG

Supplier: Anaspec Inc

This is amino acids 23 to 42 fragment of beta-amyloid.
Sequence: DVGSNKGAIIGLMVGGVVIA
Molecular Weight: 1870.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.
Sequence:LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
MW:4195.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Guinea Pig IL-1 beta/IL-1F2 Protein from R&D Systems is derived from E. coli. The Recombinant Guinea Pig IL-1 beta/IL-1F2 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Human His6-USP8 Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from Sf 9 (baculovirus). The Recombinant Human His6-USP8 Protein has been validated for the following applications: Enzyme Activity.

Supplier: Anaspec Inc

This peptide is histone H4 amino acid residues 1 to 21. It is acetylated at the N-terminus, and trimethylated at Lys-12 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Me3)-GGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

These 15 Cytomegalovirus (CMV) peptides, at 0.25 mg each (total of 3.75 mg/vial), constitute part of the CEF control peptide pool (cat# 61036-025). Now available separately as EBV Control Peptide Pool, CMV Control Peptide Pool (cat# 62339), Influenza control peptide pool (cat# 62340), these peptides have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays. All peptides are provided as net weight based on peptide content.
Sequence:
MW:
% peak area by HPLC:95
Storage condition:-20° C

Supplier: ACROBIOSYSTEMS INC MS

Biotinylated Human TNFSF11 / RANKL / CD254 Protein, His,Avitag™, active trimer (MALS verified), ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Human PLGF/PGF (19-149) Protein, Fc Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Leu 19 - Arg 149, Predicted N-terminus: Leu 19, protein carries a human IgG1 Fc tag at the C-terminus, Synonyms: PGF, PLGF, PlGF, PGFL, SHGC-10760, Size: 500uG