You searched for: Proteins and Peptides

Supplier: Adipogen

Interleukin-27 (IL-27) is a heterodimeric group 2 receptor ligand molecule that belongs to the IL-6/IL-12 family of long type I cytokines. It is composed of EBI3 (EBV-induced gene 3), a 34 kDa glycoprotein that is related to the p40 subunit of IL-12 and IL-23, and p28, the cloned 28 kDa glycoprotein that is related to the p35 chain of IL-12. IL-27 is expressed by monocytes, endothelial cells and dendritic cells. IL-27 binds to and signals through a heterodimeric receptor complex composed of WSX1 (TCCR) and gp130. Evidence suggests IL-27 interacts only with WSX-1. IL-27 has both anti- and proinflammatory properties. As an antiinflammatory, IL-27 seems to induce a general negative feedback program that limits T and NK-T cell activity. At the onset of infection, IL-27 induces an IL-12 receptor on naïe CD4+ T cells, making them susceptible to subsequent IL-12 activity (and possible Th1 development). Notably, IL-12 family cytokines are both induced and inhibited by bacterial products. Microbes promote IL-27 secretion through TLR4, and also block IL-27 production via C5a induction.

Supplier: Anaspec Inc

This peptide is Histone H3 with amino acid residues 69 to 89 mono-methylated at Lys-79 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDF-K(Me1)-TDLRFQSSAV-K(Biotin)
MW:2848.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: R&D Systems

The Recombinant Human KIR2DL2/CD158b1 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human KIR2DL2/CD158b1 Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Human His6-UBE2F Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from E. coli. The Recombinant Human His6-UBE2F Protein has been validated for the following applications: Enzyme Activity.

Supplier: ACROBIOSYSTEMS INC MS

Human IL-8 / CXCL8 Protein, Fc Tag, ACROBiosystems

Supplier: R&D Systems

The Recombinant Human Ephrin-A2 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human Ephrin-A2 Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Human Lymphotoxin-alpha/TNF-beta Protein from R&D Systems is derived from E. coli. The Recombinant Human Lymphotoxin-alpha/TNF-beta Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Mouse Ephrin-B3 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Mouse Ephrin-B3 Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Mouse CD300b/LMIR5 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Mouse CD300b/LMIR5 Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier: Adipogen

Interleukin-33 (IL-33; HF-NEV; IL-1F11), a member of the IL-1 family of cytokines, is expressed by many cell types following pro-inflammatory stimulation and is thought to be released upon cell lysis. IL-33 binds to and signals through ST2 (IL-1R1) and its stimulation recruits MYD88, IRAK, IRAK4 and TRAF6, followed by phosphorylation of ERK1 (MAPK3) / ERK2 (MAPK1), p38 (MAPK14) and JNK. The ability of IL-33 to target numerous immune cell types, like Th2-like cells, mast cells and B1 cells, and to induce cytokine and chemokine production underlines its potential in influencing the outcome of a wide range of diseases, such as arthritis, asthma, atopic allergy & anaphylaxis, cardiovascular disease/atherosclerosis, nervous system diseases and sepsis. IL-33 facilitates Treg expansion in vitro and in vivo. Recently, IL-33 has been involved in adipocyte differentiation. The biological activity of IL-33 at its receptor ST2 is rapidly terminated in the extracellular environment by its oxidation (formation of two disulfide bridges), resulting in an extensive conformational change that disrupts the ST2 binding site. Mutations at amino acids C208S/C232S protect IL-33 from oxidation and increase its activity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Mouse B7-H2 His-tag Protein from R&D Systems is derived from NS0. The Recombinant Mouse B7-H2 His-tag Protein has been validated for the following applications: Bioactivity.

Supplier: ACROBIOSYSTEMS INC MS

Human CD39 Protein, Mouse IgG2a Fc Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Human GUCY2C / Guanylyl cyclase C Protein, His Tag, ACROBiosystems

Supplier: Anaspec Inc

This sequence is from the C-terminal sequence of the P and V proteins of Simian Virus 5.
Sequence:GKPIPNPLLGLDST
MW:1421.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 23 to 34 mono-methylated at Lys-27.
Sequence:KAAR-K(Me1)-SAPATGG
MW:1128.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: R&D Systems

The Recombinant Human IFN-alpha/beta R1 Protein from R&D Systems is derived from NS0. The Recombinant Human IFN-alpha/beta R1 Protein has been validated for the following applications: Bioactivity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Anaspec Inc

This Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43. This short mimetic peptide reversibly inhibits the gap junction-dependent propagation of Ca2+ waves between tracheal airway epithelial cells.
Sequence:VCYDKSFPISHVR
MW:1550.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: ACROBIOSYSTEMS INC MS

Human CLEC12A/MICL/CLL-1 Protein, Fc, Avitag*, Biotinylated, Source: expressed from human 293 cells (HEK293). It contains AA His 65 - Ala 265, Predicted N-terminus: Gly, protein carries an Avi tag at N-terminus, followed by a human IgG1 Fc tag, Synonyms: CLEC12A, MICL, CLL-1, CLL1, Size: 200uG

Supplier: ACROBIOSYSTEMS INC MS

Biotinylated Human CD36 / SR-B3 Protein, His,Avitag™, ACROBiosystems

Supplier: R&D Systems

The Recombinant Human His6-USP1 Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from Sf 21 (baculovirus). The Recombinant Human His6-USP1 Protein has been validated for the following applications: Bioactivity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Human UBE2I/Ubc9 Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from E. coli. The Recombinant Human UBE2I/Ubc9 Protein has been validated for the following applications: Enzyme Activity.

Supplier: ACROBIOSYSTEMS INC MS

Cynomolgus B7-H3 / CD276 Protein, His Tag (MALS verified), ACROBiosystems

Supplier: R&D Systems

The Recombinant Human t-Plasminogen Activator/tPA Protein from R&D Systems is derived from CHO. The Recombinant Human t-Plasminogen Activator/tPA Protein has been validated for the following applications: Enzyme Activity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Anaspec Inc

Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C