You searched for: Proteins and Peptides
Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.
Chicken OVA (257-264)
Supplier: Anaspec Inc
FILKSINE is the scrambled version of ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: FILKSINE
MW: 963.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
Human Recombinant Lysosomal Pro-X Carboxypeptidase
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Mouse Recombinant Secreted CD137 antigen
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant TGF-beta 1 (from Baculovirus (Sf9 Insect Cells))
Supplier: R&D Systems
The Recombinant Human TGF-beta 1, ACFP Protein from R&D Systems is derived from Sf 9 (baculovirus). The Recombinant Human TGF-beta 1, ACFP Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human Recombinant GABA(A) Receptor-Associated Protein
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Cynomolgus monkey Recombinant CD73 (from HEK293 cells)
Supplier: ACROBIOSYSTEMS INC MS
Cynomolgus CD73 Protein, His Tag (active enzyme), ACROBiosystems
Expand 1 Items
Rhesus macaque Recombinant Glypican 2 (from HEK293 cells)
Supplier: ACROBIOSYSTEMS INC MS
Rhesus macaque Glypican 2 / GPC2 Protein, His Tag, ACROBiosystems
Expand 1 Items
Human Recombinant Type I inositol 1,4,5-trisphosphate 5-phosphatase
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
HCoV-HKU1(isolate N5) Recombinant S1 protein (from HEK293 cells)
Supplier: ACROBIOSYSTEMS INC MS
HCoV-HKU1(isolate N5) S1 protein, His Tag, ACROBiosystems
Expand 1 Items
Human Trim5 Ch37, Bon Opus Biosciences
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
SARS-CoV-2 Recombinant S protein (from HEK293 cells), Biotin
Supplier: ACROBIOSYSTEMS INC MS
Biotinylated SARS-CoV-2 S protein, His,Avitag™, Super stable trimer (MALS verified), ACROBiosystems
Expand 1 Items
Forkhead derived peptide
Supplier: Anaspec Inc
This peptide is used as a substrate for the DYRK family of kinases in in-vitro analysis. Also known as woodtide, this peptide corresponds to residues 324 to 334 of transcription factor FKHR with two lysine residues added at the N-terminus to facilitate binding to phosphocellulose paper.
Sequence:KKISGRLSPIMTEQ-NH2
MW:1586.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant Angiostatin (from NS0 cells)
Supplier: R&D Systems
The Recombinant Human Angiostatin Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human Angiostatin Fc Chimera Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human Recombinant SCGF/CLEC11a (from NS0 Cells)
Supplier: R&D Systems
The Recombinant Human SCGF-alpha/CLEC11a Protein from R&D Systems is derived from NS0. The Recombinant Human SCGF-alpha/CLEC11a Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human Recombinant MAGP-2/MFAP5 (from NS0 Cells)
Supplier: R&D Systems
The Recombinant Human MAGP-2/MFAP5 Protein from R&D Systems is derived from NS0. The Recombinant Human MAGP-2/MFAP5 Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
LCMV NP396 H-2Db peptide
Supplier: Anaspec Inc
This peptide is a rat insulin promoter Lymphocytic Choriomeningitis Virus–Nucleoprotein (LCMV-NP) fragment amino acid residues 396 to 404. It is the immunodominant H-2Db restricted epitope.
Sequence:FQPQNGQFI
MW:1078.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
PEP1
Supplier: Anaspec Inc
This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.
Sequence:SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
MW:3805.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant NKG2D (from HEK293 Cells)
Supplier: ACROBIOSYSTEMS INC MS
Human NKG2D / CD314 Protein, Mouse IgG2a Fc Tag, ACROBiosystems
Expand 1 Items
Mouse Laminin alpha1 (2110-2127)
Supplier: Anaspec Inc
This peptide is derived from mouse laminin alpha1 amino acid residues 2110-2127. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.
Sequence:CSRARKQAASIKVAVSADR-NH2
MW:2016.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Fluorogenic DPPIV Substrate, AFC (Antibody-fluorophore conjugate)
Supplier: Anaspec Inc
This is a fluorescent peptide, Abs/Em=380/500. It is a substrate for dipeptidyl peptidase IV (DPP IV) and Xaa-Pro dipeptidase.
Sequence:AP-AFC
MW:397.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant Syndecan-1 (from HEK293), Unconjugated
Supplier: ACROBIOSYSTEMS INC MS
Human Syndecan-1 Protein, Fc Tag, Source: expressed from human 293 cells (HEK293). It contains AA Gln 23 - Gly 254, Predicted N-terminus: Gln 23, protein carries a human IgG1 Fc tag at the C-terminus, Synonyms: SDC1, Syndecan-1, CD138, SYND1, SDC, Size: 100uG
Expand 1 Items
Human Recombinant Vascular endothelial Growth Factor receptor 2
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant CMRF35-like molecule 8
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Rat Recombinant CD27/TNFRSF7 (from NS0 cells)
Supplier: R&D Systems
The Recombinant Rat CD27/TNFRSF7 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Rat CD27/TNFRSF7 Fc Chimera Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human Recombinant Natural Cytotoxicity Triggering Receptor 1
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
[Lys(Me1)18]-Histone H3 (1-21)-GGK,Biotin
Supplier: Anaspec Inc
This peptide is Histone H3 (1-21). It is monomethylated at lysine 18 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant Protocadherin-17 (from HEK293 Cells)
Supplier: R&D Systems
The Recombinant Human Protocadherin-17 Protein from R&D Systems is derived from HEK293. The Recombinant Human Protocadherin-17 Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Mouse Recombinant CD84/SLAMF5 (from NS0 cells)
Supplier: R&D Systems
The Recombinant Mouse CD84/SLAMF5 Protein from R&D Systems is derived from NS0. The Recombinant Mouse CD84/SLAMF5 Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Mouse Recombinant FGF-4 (from E. coli)
Supplier: R&D Systems
The Recombinant Mouse FGF-4 (aa 67-202) Protein from R&D Systems is derived from E. coli. The Recombinant Mouse FGF-4 (aa 67-202) Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Mouse Recombinant Serpin A1a (from NS0 cells)
Supplier: R&D Systems
The Recombinant Mouse Serpin A1a Protein from R&D Systems is derived from NS0. The Recombinant Mouse Serpin A1a Protein has been validated for the following applications: Inhibition Activity.
Expand 1 Items
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: BDH
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International