Mouse Recombinant IL-19 (from E. coli)
Supplier: Shenandoah Biotechnology
Certificates
About this item
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
- High quality
- Low endotoxin
- Affordable
IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Certifications: Animal-Free (AF) proteins are identical to regular proteins and offer additional documentation showing that they were produced with no materials of animal or human origin using ANIMAL-FREE purification processes.
Caution: For research use only.
Specifications
- Conjugatie:Onconjugeerd
- Protein function:Cytokine
- Protein/peptide type:Recombinant
- Bron:E. coli
- Species:Mouse
- Storage conditions:−20 °C
- Endotoxinegehalte:Endotoxin LAL (EU/µg) ≤0.1
- Biologische activiteiten:Bioactivity: No biological activity data is available at this time
- Gen-ID:Q8CJ70
- Reconstitution instructions:Sterile water at 0,1 mg/ml
- Endotoxinevrij:N
- Dragervrij:Y
- Protease-free:N
- Diervrij:N
- Protein synonyms:IL19|IL-19|Interleukin 19
- UniProtKB:Q8CJ70
- Protein/peptide name:IL-19
- Zuiverheid:≥95%
- Moleculair gewicht:17,7 kDa
- Sequentie:MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Formulering:10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- Vrij van nucleasen:N
- Nr:RUO
- Shipping temperature:RT
Specifications
Frequently Bought Together