Anti-14-3-3 gamma/YWHAG Rabbit Monoclonal Antibody [clone: ARC1457]
ANTIA309079-100
New Product
- Type d'anticorps:Primaire
- Nom de l'antigène:14-3-3 gamma / YWHAG
- Symbole de l'antigène:14-3-3 gamma / YWHAG
- Clonalité:Monoclonal
- Clone:ARC1457
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# P61981
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:28 kDa
- Sequence:VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981).
- Tested applications:IHC
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Rabbit monoclonal [ARC1457] antibody to 14-3-3 gamma/YWHAG for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: 14-3-3 gamma / YWHAG
Clonality: Monoclonal
Clone: ARC1457
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat