Anti-TMF Rabbit Polyclonal Antibody
ANTIA307488-100
New Product
- Type d'anticorps:Primaire
- Symbole de l'antigène:TMF
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- Isotype:IgG
- Réactivité:Human,Mouse
- Western blot:Yes
- Formulaire:Liquid
- ID de gène:UniprotID# P82094
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% Thiomersal
- Molecular weight:160 kDa
- Sequence:MKVEQERKKAIFTQETIKEKERKPFSVSSTPTMSRSSSISGVDMAGLQTSFLSQDESHDHSFGPMPISANGSNLYDAVRMGAGSSIIENLQSQLKLREGEI
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TMF1 (NP_009045.2).
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Rabbit polyclonal antibody to TMF for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: TMF
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse