Anticorps polyclonal de lapin anti-53BP1
Catalog # ANTIA305436-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Type d'anticorps:Primaire
- Nom de l'antigène:53 BP1
- Symbole de l'antigène:53BP1
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human
- Formulaire:Liquid
- ID de gène:UniprotID# Q12888
- Synonymes antigène:FLJ41424|p53 BP1|p53-binding protein 1|p53 binding protein 1|TP53 BP1|MGC138366|53BP1|p53BP1|p202
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Sequence:ASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTER
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 1103 - 1200 of human TP53BP1 (NP_005648.1).
- Tested applications:IHC
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Specifications
About this item
Anticorps polyclonal de lapin contre 53BP1 pour IHC avec des échantillons humains.
- Applications validées : IHC
- Dilutions recommandées : IHC : 1:50 à 1:200
Type : Primaire
Antigène : 53BP1
clonalité : Polyclonal
Clone:
Conjugaison : Non conjugué
Épitope :
Hôte : Lapin
Isotype: IgG
Réactivité : Humain