Anticorps monoclonal de lapin anti-alpha internexine [Clone : ARC2054]
Catalog # ANTIA305822-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Type d'anticorps:Primaire
- Nom de l'antigène:66 kDa neurofilament protein
- Symbole de l'antigène:alpha Internexin
- Clonalité:Monoclonal
- Clone:ARC2054
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Formulaire:Liquid
- ID de gène:UniprotID# Q16352
- Synonymes antigène:Alpha Inx|Alpha-internexin|MGC12702|INA|Alpha-Inx|alpha Internexin|AINX_HUMAN|Internexin neuronal intermediate filament protein alpha|NEF 5
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:62 - 67 kDa
- Sequence:EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:A synthetic peptide corresponding to a sequence within amino acids 350 - 450 of human Alpha Internexin (Q16352).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Specifications
About this item
Anticorps monoclonal de lapin [ARC2054] contre alpha internexine pour WB, IHC et ICC/IF avec des échantillons provenant d'humains, de souris et de rats.
- Applications validées : WB, IHC, ICC/ IF
- Dilutions recommandées : WB : 1:500 à 1:2000, IHC : 1:50 à 1:200, ICC/IF : 1:50 à 1:200
Type : Primaire
Antigène : alpha internexine
Clonalité : Monoclonal
Clone : ARC2054
Conjugaison: Non conjugué
Épitope :
Hôte : Lapin
Isotype: IgG
Réactivité : Humain, souris, rat