Anticorps monoclonal de lapin anti-Aly/Ref [Clone : ARC0959]
Catalog # ANTIA305535-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Type d'anticorps:Primaire
- Symbole de l'antigène:Aly / Ref
- Clonalité:Monoclonal
- Clone:ARC0959
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Formulaire:Liquid
- ID de gène:UniprotID# Q86V81
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:27 kDa
- Sequence:DALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:A synthetic peptide corresponding to a sequence within amino acids 158 - 257 of human THOC4/ALYREFREF (Q86V81).
- Tested applications:IHC
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Specifications
About this item
Anticorps monoclonal de lapin [ARC0959] contre Aly/Ref pour WB et IHC avec des échantillons d’humains, de souris et de rats.
- Applications validées : WB, IHC
- Dilutions recommandées : WB : 1:500 à 1:2000, IHC : 1:50 à 1:200
Type : Primaire
Antigène : Aly/Ref
clonalité : Monoclonal
Clone : ARC0959
Conjugaison: Non conjugué
Épitope :
Hôte : Lapin
Isotype: IgG
Réactivité : Humain, souris, rat