Anti-OSCP Rabbit Polyclonal Antibody
Catalog # ANTIA305529-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Type d'anticorps:Primaire
- Nom de l'antigène:B930011D01Rik
- Symbole de l'antigène:OSCP
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# O95965
- Synonymes antigène:TIED|ITGBL1|Ten integrin EGF like repeat domain protein|OSCP|MGC99074|Osteoblast specific cysteine rich protein
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Molecular weight:54 kDa
- Sequence:CYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:A synthetic peptide corresponding to a sequence within amino acids 200 - 300 of human ITGBL1 (NP_004782.1).
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Specifications
About this item
Rabbit polyclonal antibody to OSCP for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: OSCP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat