Anticorps polyclonal de lapin anti-ANKLE2
ANTIA305517-100
New Product
- Type d'anticorps:Primaire
- Nom de l'antigène:ANKL2_HUMAN
- Symbole de l'antigène:ANKLE2
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Formulaire:Liquid
- ID de gène:UniprotID# Q86XL3
- Synonymes antigène:FLJ36132|ANKLE2|KIAA 0692|ANKLE 2|FLJ22280|FLJ 36132|FLJ 22280|Ankyrin repeat and LEM domain-containing protein 2|ankyrin repeat and LEM domain containing 2
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Molecular weight:104 kDa
- Sequence:CRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPE
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 350 - 450 of human ANKLE2 (NP_055929.1).
- Tested applications:IHC
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Anticorps polyclonal de lapin contre ANKLE2 pour WB et IHC avec des échantillons d’humains, de souris et de rats.
- Applications validées : WB, IHC
- Dilutions recommandées : WB : 1:500 à 1:2000, IHC : 1:50 à 1:200
Type : Primaire
Antigène : ANKLE2
clonalité : Polyclonal
Clone:
Conjugaison : Non conjugué
Épitope :
Hôte : Lapin
Isotype: IgG
Réactivité : Humain, souris, rat