Anticorps polyclonal de lapin anti-ATP6V1G2
N° de catalogue ANTIA305403-100
Fournisseur: ANTIBODIES.COM
New Product
Spécifications
- Type d'anticorps:Primaire
- Nom de l'antigène:ATP6G
- Symbole de l'antigène:ATP6V1G2
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Formulaire:Liquid
- ID de gène:UniprotID# O95670
- Synonymes antigène:ATP6V1G2|OTTHUMP00000036060|ATP6G2|ATPase H+ transporting lysosomal 13kDa V1 subunit G2|OTTHUMP00000036058|H(+) transporting two sector ATPase subunit G2|ATPase H+ transporting lysosomal (vacuolar proton pump) subunit G|NG 38|NG38
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Molecular weight:14 kDa
- Sequence:AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLL
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 40 - 100 of human ATP6V1G2 (NP_569730.1).
- Tested applications:IHC
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Spécifications
À propos de cet article
Anticorps polyclonal de lapin contre ATP6V1G2 pour WB et IHC avec des échantillons d’humains, de souris et de rats.
- Applications validées : WB, IHC
- Dilutions recommandées : WB : 1:500 à 1:1000, IHC : 1:50 à 1:200
Type : Primaire
Antigène : ATP6V1G2
clonalité : Polyclonal
Clone:
Conjugaison : Non conjugué
Épitope :
Hôte : Lapin
Isotype: IgG
Réactivité : Humain, souris, rat