Recombinant DegP from E. coli
À propos de cet article
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
2 Options disponibles ci-dessous
Product Details & Documents
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
Spécifications de la famille de produits
Spécifications
Spécifications
- Catalog No:
- BMOL373034.20
- BMOL373034.100
- Nom de la protéine/du peptide:
- DegP
- DegP
- Synonyme de protéine:
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- Type de protéine/peptide:
- Recombinant
- Recombinant
- Source:
- E. coli
- E. coli
- Conjugaison:
- Unconjugated
- Unconjugated
- ID de gène:
- 947139
- 947139
- Sequence:
- AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ - AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
- Nombre d'acides aminés:
- 27 - 474
- 27 - 474
- Base de données UnitProt:
- P0C0V0
- P0C0V0
- Purity:
- ≥90% (SDS-PAGE)
- ≥90% (SDS-PAGE)
- Formulation:
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Masse moléculaire:
- 48,8 kD
- 48,8 kD
- Conditions de stockage:
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Température de transport:
- 4 °C
- 4 °C
Spécifications
Product Family Options
Informations sur le produit
- CdtDisponibilitéPrix
- Spécifications :
Plus
Specifications
Cat. No.BMOL373034.20Nom de la protéine/du peptideDegPSynonyme de protéinehtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Type de protéine/peptideRecombinantSourceE. coliConjugaisonUnconjugatedID de gène947139SequenceAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQNombre d'acides aminés27 - 474Base de données UnitProtP0C0V0Purity≥90% (SDS-PAGE)FormulationSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolMasse moléculaire48,8 kDConditions de stockageMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Température de transport4 °C - Spécifications :
Plus
Specifications
Cat. No.BMOL373034.100Nom de la protéine/du peptideDegPSynonyme de protéinehtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Type de protéine/peptideRecombinantSourceE. coliConjugaisonUnconjugatedID de gène947139SequenceAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQNombre d'acides aminés27 - 474Base de données UnitProtP0C0V0Purity≥90% (SDS-PAGE)FormulationSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolMasse moléculaire48,8 kDConditions de stockageMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Température de transport4 °C
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.
Catalog #: 83639.320
Fournisseur: VWR Chemicals
Catalog #: 20864.320
Fournisseur: VWR Chemicals
Catalog #: 83640.320
Fournisseur: VWR Chemicals
Catalog #: 1.00030.2500
Fournisseur: Merck
Catalog #: 31770.294
Fournisseur: VWR Chemicals
Catalog #: 83645.320
Fournisseur: VWR Chemicals
Catalog #: 1.09439.1000
Fournisseur: Merck