Anti-Aspartate beta hydroxylase Rabbit Polyclonal Antibody
Catalog # ANTIA10018-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Aspartyl/asparaginyl beta hydroxylase
- Antigen symbol:Aspartate beta hydroxylase
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Form:Liquid
- Gene ID:UniprotID# Q12797
- Antigen synonyms:Aspartate beta hydroxylase|CASQ2BP1|BAH|AAH|ASP beta hydroxylase|A beta H J J|ASPH|Cardiac junctin|ASPH_HUMAN
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Sequence:EEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 81 - 270 of human ASPH (NP_001158227.1)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Aspartate beta hydroxylase for ICC/IF with samples derived from human.
- Validated Applications: ICC/IF
- Recommended Dilutions: ICC/IF: 1:50 to 1:100
Type: Primary
Antigen: Aspartate beta hydroxylase
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human