Human recombinant CXCL4 (from E. coli)
Supplier: Biorbyt
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biological activity:ED50 is 515 ug/mL as determined by the ability of Recombinant CXCL4 to inhibit human FGF basic dependent proliferation of NR6R3T3 mouse fibroblasts.
- Protein synonyms:Platelet Factor 4
- UniProtKB:P02776 (Human)
- Protein/peptide name:CXCL4
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIK KLLES
- Formulation:Lyophilized from a 0.2 um filtered solution of 50mM TrisHCl, 150mM NaCl, pH 8.0.
- Tested applications:SDS-PAGE , FuncS
Specifications
Frequently Bought Together