Human recombinant IL4 (from E. coli)
Marketsource
Supplier: Biorbyt
About this item
3 Options Available Below
Product Details & Documents
Documents
orb49480
Datasheet
Specifications for Product Family
Specifications
Specifications
- Catalog No:
- BIRBORB49480-10
- BIRBORB49480-50
- BIRBORB49480-1
- Protein/peptide name:
- IL4
- IL4
- IL4
- Protein synonyms:
- B cell growth factor 1
- B cell growth factor 1
- B cell growth factor 1
- Protein/peptide type:
- Recombinant
- Recombinant
- Recombinant
- Species:
- Human
- Human
- Human
- Source:
- E. coli
- E. coli
- E. coli
- Conjugation:
- Unconjugated
- Unconjugated
- Unconjugated
- Sequence:
- MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTR CLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
- MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTR CLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
- MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTR CLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
- UniProtKB:
- P05112 (Human)
- P05112 (Human)
- P05112 (Human)
- Biological activity:
- ED50 is less than 2 ng/ml as determined by the dosedependent stimulation of TF1 cells.
Specific Activity of 5.0 x 106 IU/mg. - ED50 is less than 2 ng/ml as determined by the dosedependent stimulation of TF1 cells.
Specific Activity of 5.0 x 106 IU/mg. - ED50 is less than 2 ng/ml as determined by the dosedependent stimulation of TF1 cells.
Specific Activity of 5.0 x 106 IU/mg.
- Purity:
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Storage conditions:
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Tested applications:
- SDS-PAGE , FuncS
- SDS-PAGE , FuncS
- SDS-PAGE , FuncS
Specifications
Product Family Options
Product Information
- PkAvailabilityPrice
- Specifications:Marketsource
More
Specifications
Cat. No.BIRBORB49480-10Protein/peptide nameIL4Protein synonymsB cell growth factor 1Protein/peptide typeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTR CLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSUniProtKBP05112 (Human)Biological activityED50 is less than 2 ng/ml as determined by the dosedependent stimulation of TF1 cells.
Specific Activity of 5.0 x 106 IU/mg.Purity>95% as determined by reducing SDS-PAGE.FormulationLyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Storage conditionsStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Tested applicationsSDS-PAGE , FuncSMarketsource - Specifications:Marketsource
More
Specifications
Cat. No.BIRBORB49480-50Protein/peptide nameIL4Protein synonymsB cell growth factor 1Protein/peptide typeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTR CLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSUniProtKBP05112 (Human)Biological activityED50 is less than 2 ng/ml as determined by the dosedependent stimulation of TF1 cells.
Specific Activity of 5.0 x 106 IU/mg.Purity>95% as determined by reducing SDS-PAGE.FormulationLyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Storage conditionsStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Tested applicationsSDS-PAGE , FuncSMarketsource - Specifications:Marketsource
More
Specifications
Cat. No.BIRBORB49480-1Protein/peptide nameIL4Protein synonymsB cell growth factor 1Protein/peptide typeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTR CLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSUniProtKBP05112 (Human)Biological activityED50 is less than 2 ng/ml as determined by the dosedependent stimulation of TF1 cells.
Specific Activity of 5.0 x 106 IU/mg.Purity>95% as determined by reducing SDS-PAGE.FormulationLyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Storage conditionsStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Tested applicationsSDS-PAGE , FuncSMarketsource
Recommendations
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.



