Anti-FABP4 Rabbit Monoclonal Antibody [clone: ARC0616]
ANTIA307097-100
New Product
- Antibody type:Primary
- Antigen name:3T3-L1 lipid-binding protein
- Antigen symbol:FABP4
- Clonality:Monoclonal
- Clone:ARC0616
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P15090
- Antigen synonyms:adipocyte|422/aP2|ALBP|Adipocyte lipid binding protein|A-FABP|Adipocyte lipid-binding protein|Adipocyte protein AP2|AFABP|Adipocyte-type fatty acid-binding protein
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:15 kDa
- Sequence:MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDG
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP4 (P15090).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0616] antibody to FABP4 for WB with samples derived from Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: FABP4
Clonality: Monoclonal
Clone: ARC0616
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse;Rat