Anti-BCKDK Rabbit Monoclonal Antibody [clone: ARC2875]
Catalog # ANTIA307436-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:BCKD kinase
- Antigen symbol:BCKDK
- Clonality:Monoclonal
- Clone:ARC2875
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O14874
- Antigen synonyms:Branched chain ketoacid dehydrogenase kinase|Bckdk|BCKDKD|BCKD_HUMAN|BCKDH kinase|BCKD-kinase|BCKDHKIN|Branched chain alpha keto acid dehydrogenase kinase|BDK
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:46 kDa
- Sequence:MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPV
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BCKDK (O14874).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2875] antibody to BCKDK for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:100 to 1:500
Type: Primary
Antigen: BCKDK
Clonality: Monoclonal
Clone: ARC2875
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat