Anti-Peroxiredoxin 6 Rabbit Monoclonal Antibody [clone: ARC0954]
Catalog # ANTIA306396-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:1 Cys
- Antigen symbol:Peroxiredoxin 6
- Clonality:Monoclonal
- Clone:ARC0954
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P30041
- Antigen synonyms:9430088D19Rik|1-Cys PRX|Acidic calcium independent phospholipase A2|24 kDa protein|1 cysPrx|1-Cys peroxiredoxin|AA690119|1 Cys peroxiredoxin|1 Cys PRX
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:25 kDa
- Sequence:KGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 125-224 of human Peroxiredoxin 6 (P30041).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0954] antibody to Peroxiredoxin 6 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: Peroxiredoxin 6
Clonality: Monoclonal
Clone: ARC0954
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat