Anti-HE4 Rabbit Monoclonal Antibody [clone: ARC53195]
ANTIA305740-100
New Product
- Antibody type:Primary
- Antigen name:dJ461P17.6
- Antigen symbol:HE4
- Clonality:Monoclonal
- Clone:ARC53195
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q14508
- Antigen synonyms:Epididymis specific whey acidic protein type four disulfide core|epididymal protein 4|Major epididymis specific protein E4|EDDM4|MGC57529|Major epididymis-specific protein E4|HE 4|HE4|Epididymal secretory protein E4
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,05% proclin 300
- Molecular weight:23 kDa
- Sequence:EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 31 - 124 of human HE4/WFDC2 (NP_006094.3).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC53195] antibody to HE4 for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:1000
Type: Primary
Antigen: HE4
Clonality: Monoclonal
Clone: ARC53195
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human