Anti-HE4 Rabbit Monoclonal Antibody [clone: ARC1936]
Catalog # ANTIA305524-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:dJ461P17.6
- Antigen symbol:HE4
- Clonality:Monoclonal
- Clone:ARC1936
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q14508
- Antigen synonyms:Epididymis specific whey acidic protein type four disulfide core|epididymal protein 4|Major epididymis specific protein E4|EDDM4|MGC57529|Major epididymis-specific protein E4|HE 4|HE4|Epididymal secretory protein E4
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:22 kDa
- Sequence:CTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 45 - 124 of human HE4/WFDC2 (Q14508).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1936] antibody to HE4 for WB and ICC/IF with samples derived from human and mouse.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: HE4
Clonality: Monoclonal
Clone: ARC1936
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse