Anti-TNFA Rabbit Polyclonal Antibody
BSBTPA1079
- Antibody type:Primary
- Antigen name:Tumor Necrosis Factor Alpha
- Antigen symbol:TNFA
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Epitope:C-Terminal
- Cross adsorption:No
- Form:Lyophilised
- Antigen synonyms:tumor necrosis factor ligand superfamily member 2|tumor necrosis factor alpha|DIF|monocyte-derived|Tnfa|cachectin|Tnfsf1a|TNFalpha|member 2|TNF-alpha|TNF-a|TNFSF2|macrophage-derived|TNF superfamily|TNF|tumor necrosis factor-alpha|APC1 protein
- Amino acid number:201 - 233
- Sequence:QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
- Storage temperature:–20 °C
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human TNF alpha (201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids.
- Purification:purified by immunogen affinity purification
- Size:100 µg/vial
- Pk:0,1 mg
Rabbit IgG polyclonal antibody for Tumor necrosis factor(TNF) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Reconstitute with distilled water.
Add 0,2 ml of distilled water will yield a concentration of 500 μg/ml.
Type: Primary
Antigen: TNFA
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope: C-Terminal
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat