Anti-RNASET2 Rabbit Polyclonal Antibody
NOVUNBP1-88753
- Antibody type:Primary
- Antigen symbol:RNASET2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Gene ID:8635
- Antigen synonyms:EC 3.1.27.-|RNASE6PLbA514O12.3|FLJ42372|FLJ10907|ribonuclease T2|EC 3.1.27.1|Ribonuclease 6
- Storage buffer:PBS (pH 7,2) and 40% Glycerol
- Storage temperature:Store at 4 °C short term. Aliquot and store at -20 °C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:FPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIP
- Purification:Immunogen affinity purified
- Size:100 μl
- Pk:0,1 mL
The RNASET2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNASET2. This antibody reacts with human. The RNASET2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: RNASET2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human