Human recombinant CXCL14 (from E. coli)
: Biorbyt
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biological activity:ED50 is 1.010.0 ng/ml as determined by the ability of Recombinant CXCL14 to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells.
- Protein synonyms:C-X-C motif chemokine 14
- UniProtKB:O95715 (Human)
- Protein/peptide name:CXCL14
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWY NAWNEKRRVYEE
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.
- Tested applications:SDS-PAGE , FuncS
Frequently Bought Together