Anti-GCLM Rabbit Monoclonal Antibody [clone: ARC0597]
Artikelnr. ANTIA81176-100
Lieferant: ANTIBODIES.COM
New Product
Spezifikationen
- Antikörper-Typ:Primär
- Antigen-Name:Gamma ECS regulatory subunit
- Antigen-Symbol:GCLM
- Klonalität:Monoklonal
- Klon:ARC0597
- Konjugation:Unconjugated
- Wirt:Rabbit
- Isotyp:IgG
- Reaktivität:Human
- Western blot:Yes
- Form:Liquid
- Gen-ID:UniprotID# P48507
- Antigen-Synonyme:GSC light chain|Gamma-glutamylcysteine synthetase regulatory subunit|Glutamate cysteine ligase regulatory subunit|Gamma-ECS regulatory subunit|GLCLR|GCS light chain|Glutamate--cysteine ligase modifier subunit|GCLM|Glutamate--cysteine ligase regulatory subunit
- Lagerungspuffer:Supplied in phosphate buffered saline, pH 7,3, with 50% Glycerol, 0,05% BSA, and 0,02% Sodium azide
- Molecular weight:30 kDa
- Sequence:LYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
- Lagertemperatur:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Transporttemperatur:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507)
- Reinigung:Affinity purification
- Packung:Plastic vial
- VE:100 µl
Spezifikationen
Über diesen Artikel
Rabbit monoclonal [ARC0597] antibody to GCLM for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: GCLM
Clonality: Monoclonal
Clone: ARC0597
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human