Anti-TNFA Rabbit Polyclonal Antibody
Catalog # BSBTPA1079
Supplier: Boster Bio
Specifications
- Antikörper-Typ:Primär
- Antigen-Name:Tumor Necrosis Factor Alpha
- Antigen-Symbol:TNFA
- Klonalität:Polyklonal
- Konjugation:Unconjugated
- Wirt:Rabbit
- ImmunoChemie:Yes
- Isotyp:IgG
- Reaktivität:Human,Rat,Mouse
- Western blot:Yes
- Epitop:C-Terminal
- Kreuzadsorption:No
- Form:Lyophilised
- Antigen-Synonyme:tumor necrosis factor ligand superfamily member 2|tumor necrosis factor alpha|DIF|monocyte-derived|Tnfa|cachectin|Tnfsf1a|TNFalpha|member 2|TNF-alpha|TNF-a|TNFSF2|macrophage-derived|TNF superfamily|TNF|tumor necrosis factor-alpha|APC1 protein
- Aminosäurezahl:201 - 233
- Sequence:QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
- Lagertemperatur:–20 °C
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human TNF alpha (201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids.
- Reinigung:purified by immunogen affinity purification
- Größe:100 µg/vial
- VE:0,1 mg
Specifications
About this item
Rabbit IgG polyclonal antibody for Tumor necrosis factor(TNF) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Reconstitute with distilled water.
Add 0,2 ml of distilled water will yield a concentration of 500 μg/ml.
Type: Primary
Antigen: TNFA
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope: C-Terminal
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat