Human recombinant CST2 (from HEK293 cells)
: Biorbyt
- Konjugation:Unconjugated
- Protein/Peptid-Typ:Rekombinant
- Ursprung:HEK293 cells
- Spezies:Human
- Lagerbedingungen:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Proteinsynonym:CystatinSA
- UniProtKB:P09228 (Human)
- Protein/Peptid-Name:CST2
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRVLRAREQIVGGVNYFF DIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQEAVDHHHHHH
- Zusammensetzung:Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
- Validierte Anwendungen:SDS-PAGE
Frequently Bought Together