Human recombinant CXCL9 (from HEK293 cells)
: Biorbyt
- Konjugation:Unconjugated
- Protein/Peptid-Typ:Rekombinant
- Ursprung:HEK293 cells
- Spezies:Human
- Lagerbedingungen:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Proteinsynonym:MIG-1
- UniProtKB:Q07325 (Human)
- Protein/Peptid-Name:CXCL9
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIK KWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTVDHHHHHH
- Zusammensetzung:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
- Validierte Anwendungen:SDS-PAGE
Frequently Bought Together
Aceton ≥99%, TECHNICAL
: VWR Chemicals
VWR® NITRILE LIGHT, Nitrilhandschuhe
: VWR Collection
VWR®, Transferpipetten, High Performance
: VWR Collection
Wasser, HiPerSolv CHROMANORM® für die HPLC
: VWR Chemicals
Nitrilhandschuhe, Kimtech™ Purple Nitrile™
: KIMBERLY CLARK
VWR®, Serologische Pipetten, Standard Serie
: VWR Collection
VWR® Gesichtstücher
: VWR Collection
VWR®, Nitrilhandschuhe
: VWR Collection