Human Recombinant Growth hormone (from E. coli)
: Biorbyt
- Konjugation:Unconjugated
- Protein/Peptid-Typ:Rekombinant
- Ursprung:E. coli
- Spezies:Human
- Lagerbedingungen:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Proteinsynonym:Somatotropin
- UniProtKB:P06880 (Mouse)
- Protein/Peptid-Name:Growth Hormone
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKE EAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDG SPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
- Zusammensetzung:Lyophilized from a 0.2 um filtered solution of 50mM TrisHCl, 500mM NaCl, pH 8.0.
- Validierte Anwendungen:SDS-PAGE
Frequently Bought Together