Anti-FOS Mouse Monoclonal Antibody [clone: 2C9]
Artikelnr. ABNOH00002353-M63
Lieferant: Abnova
Spezifikationen
- Antikörper-Typ:Primär
- Antigen-Name:FBJ Murine Osteosarcoma Viral Oncogene Homolog
- Antigen-Symbol:FOS
- Klonalität:Monoklonal
- Klon:2C9
- Konjugation:Unconjugated
- ELISA:Yes
- Wirt:Mouse
- Isotyp:IgG2a kappa
- Reaktivität:Human
- Western blot:Yes
- Kreuzadsorption:No
- Format:Liquid
- Gen-ID:2353
- Antigen-Synonyme:V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog|AP-1|p55|C-FOS|G0/G1 Switch Regulatory Protein 7
- Aminosäurezahl:1 to 100
- Lagerungspuffer:1x PBS, pH 7,4
- Sequence:MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
- Lagertemperatur:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:FOS (NP_005243.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Größe:100 µg
- VE:100 µg
Spezifikationen
Über diesen Artikel
Mouse monoclonal antibody raised against a partial recombinant FOS.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: FOS
Clonality: Monoclonal
Clone: 2C9
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human