Anti-ATP2B4 Mouse Monoclonal Antibody [clone: 2C7]
Catalog # ABNOH00000493-M03A
Supplier: Abnova
Specifications
- Antikörper-Typ:Primär
- Antigen-Name:ATPase, Ca++ transporting, plasma membrane 4
- Antigen-Symbol:ATP2B4
- Klonalität:Monoklonal
- Klon:2C7
- Konjugation:Unconjugated
- ELISA:Yes
- Wirt:Mouse
- Isotyp:IgG1 kappa
- Reaktivität:Human
- Western blot:Yes
- Kreuzadsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gen-ID:493
- Antigen-Synonyme:MXRA1|PMCA4|PMCA4b|PMCA4x|ATP2B2
- Aminosäurezahl:1 to 92
- Sequence:MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
- Lagertemperatur:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ATP2B4 (NP_001675, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Größe:200 μl
- VE:200 µl
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant ATP2B4.
Type: Primary
Antigen: ATP2B4
Clonality: Monoclonal
Clone: 2C7
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human